Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbfox2 Peptide - N-terminal region

Rbfox2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810460A15Rik, AA407676, AI118529, Fbm2, Fxh, Hrnbp2, Rbm9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rbfox2 Rabbit Polyclonal Antibody (orb324719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104297

Preservative

Lyophilized powder

AA Sequence

PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluoroadenosine
TRC-F587218-250MG 250 mg

2-Fluoroadenosine

Sign In for Pricing
View Details
Rat Ubiquitin (Ub) ELISA Kit
RDR-Ub-Ra-01 96 Tests

Rat Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin (Ub) ELISA Kit
RDR-Ub-Ra-02 48 Tests

Rat Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
COPA (NM_001098398) Human Over-expression Lysate
LC420566 20 µg

COPA (NM_001098398) Human Over-expression Lysate

Sign In for Pricing
View Details
Delta-Tocopherol (>90%)
TRC-T526150-5G 5 g

Delta-Tocopherol (>90%)

Sign In for Pricing
View Details
TSG Human
OM296852-01 10 µg

TSG Human

Sign In for Pricing
View Details