Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tfdp2 Peptide - N-terminal region

Tfdp2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tcfdp2

UniProt

B5DF82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tfdp2 Rabbit Polyclonal Antibody (orb576346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100317

Preservative

Lyophilized powder

AA Sequence

IDSDFSESKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Violet 450 Anti-human CD144 Antibody *55-7H1*
114400Z1-AAT 500 Tests

MFluor™ Violet 450 Anti-human CD144 Antibody *55-7H1*

Sign In for Pricing
View Details
RNU7-24P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV774254 1.0 µg DNA

RNU7-24P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Zea mays Zein-alpha B49
MBS1145252-01 0.02 mg (E-Coli)

Recombinant Zea mays Zein-alpha B49

Sign In for Pricing
View Details
Recombinant Zea mays Zein-alpha B49
MBS1145252-02 0.1 mg (E-Coli)

Recombinant Zea mays Zein-alpha B49

Sign In for Pricing
View Details
Recombinant Zea mays Zein-alpha B49
MBS1145252-03 0.02 mg (Yeast)

Recombinant Zea mays Zein-alpha B49

Sign In for Pricing
View Details
Recombinant Zea mays Zein-alpha B49
MBS1145252-04 0.1 mg (Yeast)

Recombinant Zea mays Zein-alpha B49

Sign In for Pricing
View Details