Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tfdp2 Peptide - N-terminal region

Tfdp2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tcfdp2

UniProt

B5DF82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tfdp2 Rabbit Polyclonal Antibody (orb576346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100317

Preservative

Lyophilized powder

AA Sequence

IDSDFSESKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human VPS33B Protein - (Dry Ice)
H00026276-P01-10ug 10 µg

Recombinant Human VPS33B Protein - (Dry Ice)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)
TRV-0021366-01 100 µL

Biotin-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)
TRV-0021366-02 200 µL

Biotin-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)
TRV-0021366-03 1 mL

Biotin-Linked Monoclonal Antibody to Angiopoietin 1 (ANGPT1)

Sign In for Pricing
View Details
PUF60, NT (PUF60, FIR, ROBPI, SIAHBP1, Poly (U) -binding-splicing factor PUF60, 60kD poly (U) -binding-splicing factor, FUSE-binding protein-interacting repressor, Ro-binding protein 1, Siah-binding protein 1) (Azide free) (HRP) discontinued
040682-HRP 200 µL

PUF60, NT (PUF60, FIR, ROBPI, SIAHBP1, Poly (U) -binding-splicing factor PUF60, 60kD poly (U) -binding-splicing factor, FUSE-binding protein-interacting repressor, Ro-binding protein 1, Siah-binding protein 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
TRV056
orb1690244-01 50 mg

TRV056

Sign In for Pricing
View Details