Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naca-rs Peptide - C-terminal region

Naca-rs Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm1878

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_354689

Preservative

Lyophilized powder

AA Sequence

VMFEERICSESHLGPKAGFRKEKEVNLQELGKVELPPSWFRDLRTKYPVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF640R conjugate, 0.1mg/mL
BNC402760-100 1x 100 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Mucin-1/MUC-1 Protein (Fc Tag)
PKSH032765-01 10 µg

Recombinant Human Mucin-1/MUC-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human Mucin-1/MUC-1 Protein (Fc Tag)
PKSH032765-02 50 µg

Recombinant Human Mucin-1/MUC-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Protein A  Peroxidase Colloidal Gold, 1mL 30nm
HGP-01-30 1 mL

Protein A Peroxidase Colloidal Gold, 1mL 30nm

Sign In for Pricing
View Details
Ezrin / p81 (CPTC-Ezrin-1), CF594 conjugate, 0.1mg/mL
BNC942238-500 1x 500 µL

Ezrin / p81 (CPTC-Ezrin-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR5I1 (C-term) Rabbit Polyclonal Antibody
AP53092PU-N 400 µL

OR5I1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details