Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naca-rs Peptide - C-terminal region

Naca-rs Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm1878

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_354689

Preservative

Lyophilized powder

AA Sequence

VMFEERICSESHLGPKAGFRKEKEVNLQELGKVELPPSWFRDLRTKYPVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAT1A Human Gene Knockout Kit (CRISPR)
KN203765LP 1 Kit

MAT1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
QuantiFluo™ Acid Phosphatase Assay Kit
FACP-100 100 Tests

QuantiFluo™ Acid Phosphatase Assay Kit

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (h-CALD), CF568 conjugate, 0.1mg/mL
BNC680819-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (h-CALD), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRO3 (NM_006293) Human Over-expression Lysate
LY401899 100 µg

TYRO3 (NM_006293) Human Over-expression Lysate

Sign In for Pricing
View Details
Tab1 Mouse Gene Knockout Kit (CRISPR)
KN517117 1 Kit

Tab1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DAB1 (NM_021080) Human Over-expression Lysate
LC402829 20 µg

DAB1 (NM_021080) Human Over-expression Lysate

Sign In for Pricing
View Details