Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTB Peptide - middle region

ACTB Peptide - middle region

Product Specifications

Product Name Alternative

BRWS1, PS1TP5BP1

UniProt

P60709

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTB Rabbit Polyclonal Antibody (orb577463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001092

Preservative

Lyophilized powder

AA Sequence

TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolar Protein 3 (NOL3) Antibody
abx114218 100 µL

Nucleolar Protein 3 (NOL3) Antibody

Sign In for Pricing
View Details
AQP12A shRNA (h) Lentiviral Particles
sc-95002-V 200 µL

AQP12A shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Gck (BC011139) Mouse Tagged ORF Clone Lentiviral Particle
MR207435L4V 200 µL

Gck (BC011139) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MYB Polyclonal Antibody, Cy3 Conjugated
bs-5978R-Cy3-TR 20 µL

MYB Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Dync1li1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4994708 1.0 µg DNA

Dync1li1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
GBA3 Antibody
orb1336577 100 µg

GBA3 Antibody

Sign In for Pricing
View Details