Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTB Peptide - middle region

ACTB Peptide - middle region

Product Specifications

Product Name Alternative

BRWS1, PS1TP5BP1

UniProt

P60709

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTB Rabbit Polyclonal Antibody (orb577463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001092

Preservative

Lyophilized powder

AA Sequence

TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FEZ2 Antibody [Janelia Fluor 646]
NBP2-81716JF646 0.1 mL

Rabbit Polyclonal FEZ2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) YMGA Polyclonal Antibody
MBS7148319 Inquire

Rabbit anti-Escherichia coli (strain K12) YMGA Polyclonal Antibody

Sign In for Pricing
View Details
MPXV A29L Antibody
ANT-36761-100ug 100 µg

MPXV A29L Antibody

Sign In for Pricing
View Details
4,5-Dichloro-2-methoxybenzoic acid
233599-01 100 mg

4,5-Dichloro-2-methoxybenzoic acid

Sign In for Pricing
View Details
4,5-Dichloro-2-methoxybenzoic acid
233599-02 250 mg

4,5-Dichloro-2-methoxybenzoic acid

Sign In for Pricing
View Details
4,5-Dichloro-2-methoxybenzoic acid
233599-03 1 g

4,5-Dichloro-2-methoxybenzoic acid

Sign In for Pricing
View Details