Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPACA9 Peptide - C-terminal region

SPACA9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAST, 1700026L06Rik

UniProt

Q7TPM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPACA9 Rabbit Polyclonal Antibody (orb325890) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081559

Preservative

Lyophilized powder

AA Sequence

VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Map1b Mouse shRNA Lentiviral Particle (Locus ID 17755)
TL501385V 500 µL Each

Map1b Mouse shRNA Lentiviral Particle (Locus ID 17755)

Sign In for Pricing
View Details
ZNF420 Lentiviral Activation Particles (h)
sc-414622-LAC 200 µL

ZNF420 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
NR1I3 Protein Lysate
OCOA15423-20UG 20 µg

NR1I3 Protein Lysate

Sign In for Pricing
View Details
HSP 90α HDR Plasmid (m)
sc-420981-HDR 20 µg

HSP 90α HDR Plasmid (m)

Sign In for Pricing
View Details
Anti-ZFP95 Antibody
MBS8248066-01 0.03 mL

Anti-ZFP95 Antibody

Sign In for Pricing
View Details
Anti-ZFP95 Antibody
MBS8248066-02 0.05 mL

Anti-ZFP95 Antibody

Sign In for Pricing
View Details