Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPACA9 Peptide - C-terminal region

SPACA9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAST, 1700026L06Rik

UniProt

Q7TPM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPACA9 Rabbit Polyclonal Antibody (orb325890) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081559

Preservative

Lyophilized powder

AA Sequence

VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Aldo-keto reductase family 1 member C1 (AKR1C1) ELISA Kit
MBS2804856-01 48 Tests

Human Aldo-keto reductase family 1 member C1 (AKR1C1) ELISA Kit

Sign In for Pricing
View Details
Human Aldo-keto reductase family 1 member C1 (AKR1C1) ELISA Kit
MBS2804856-02 96 Tests

Human Aldo-keto reductase family 1 member C1 (AKR1C1) ELISA Kit

Sign In for Pricing
View Details
Human Aldo-keto reductase family 1 member C1 (AKR1C1) ELISA Kit
MBS2804856-03 5x 96 Tests

Human Aldo-keto reductase family 1 member C1 (AKR1C1) ELISA Kit

Sign In for Pricing
View Details
Human Aldo-keto reductase family 1 member C1 (AKR1C1) ELISA Kit
MBS2804856-04 10x 96 Tests

Human Aldo-keto reductase family 1 member C1 (AKR1C1) ELISA Kit

Sign In for Pricing
View Details
Porcine aFGF ELISA Kit
EPA0237 96 Tests

Porcine aFGF ELISA Kit

Sign In for Pricing
View Details
Anti-OSCAR Antibody
A02961 100 µL

Anti-OSCAR Antibody

Sign In for Pricing
View Details