Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk8ip2 Peptide - middle region

Mapk8ip2 Peptide - middle region

Product Specifications

UniProt

G3V9M2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mapk8ip2 Rabbit Polyclonal Antibody (orb582722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001055248

Preservative

Lyophilized powder

AA Sequence

SEPEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSP

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGRP Protein, Human, Recombinant (hFc Tag)
MBS8119984-01 0.1 mg

AGRP Protein, Human, Recombinant (hFc Tag)

Sign In for Pricing
View Details
AGRP Protein, Human, Recombinant (hFc Tag)
MBS8119984-02 5x 0.1 mg

AGRP Protein, Human, Recombinant (hFc Tag)

Sign In for Pricing
View Details
SNM1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2532309 100 µL

SNM1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
PLV3-U6-HERC4-shRNA3-CopGFP-Puro Plasmid
PVT66405 2 µg

PLV3-U6-HERC4-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
FIGLA (NM_001004311) Human Over-expression Lysate
LS344018 100 µg

FIGLA (NM_001004311) Human Over-expression Lysate

Sign In for Pricing
View Details
DTNA Peptide - C-terminal region
MBS3244054-01 0.1 mg

DTNA Peptide - C-terminal region

Sign In for Pricing
View Details