Mapk8ip2 Peptide - middle region
Mapk8ip2 Peptide - middle region
Product Specifications
UniProt
G3V9M2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mapk8ip2 Rabbit Polyclonal Antibody (orb582722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_001055248
Preservative
Lyophilized powder
AA Sequence
SEPEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSP
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1216576-01 0.02 mg (E-Coli)
Recombinant Lactobacillus reuteri Pantothenate kinase (coaA)
Sign In for Pricing
View Details 
MBS1216576-02 0.02 mg (Yeast)
Recombinant Lactobacillus reuteri Pantothenate kinase (coaA)
Sign In for Pricing
View Details 
MBS1216576-03 0.1 mg (E-Coli)
Recombinant Lactobacillus reuteri Pantothenate kinase (coaA)
Sign In for Pricing
View Details MBS1216576-04 0.1 mg (Yeast)
Recombinant Lactobacillus reuteri Pantothenate kinase (coaA)
Sign In for Pricing
View Details MBS1216576-05 0.02 mg (Baculovirus)
Recombinant Lactobacillus reuteri Pantothenate kinase (coaA)
Sign In for Pricing
View Details 
MBS1216576-06 0.02 mg (Mammalian-Cell)
Recombinant Lactobacillus reuteri Pantothenate kinase (coaA)
Sign In for Pricing
View Details