Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amz2 Peptide - middle region

Amz2 Peptide - middle region

Product Specifications

Product Name Alternative

RGD1304846

UniProt

Q400C7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Amz2 Rabbit Polyclonal Antibody (orb330832) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014143

Preservative

Lyophilized powder

AA Sequence

ITLHSQSDWISSHPEAPQDFEQFFSDRYRKAPCPKKHIIYIQPIGFLGNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal STMND1 Antibody [Janelia Fluor 525]
NBP3-26886JF525 0.1 mL

Rabbit Polyclonal STMND1 Antibody [Janelia Fluor 525]

Sign In for Pricing
View Details
NFKB1 (Ab-893) Antibody
A44269-100UL 100 µL

NFKB1 (Ab-893) Antibody

Sign In for Pricing
View Details
PACSIN3 Mouse Monoclonal Antibody [Clone ID: OTI4F8]
TA502249S 30 µL

PACSIN3 Mouse Monoclonal Antibody [Clone ID: OTI4F8]

Sign In for Pricing
View Details
DR5 Recombinant Rabbit mAb
orb3184705-01 25 µL

DR5 Recombinant Rabbit mAb

Sign In for Pricing
View Details
DR5 Recombinant Rabbit mAb
orb3184705-02 50 µL

DR5 Recombinant Rabbit mAb

Sign In for Pricing
View Details
DR5 Recombinant Rabbit mAb
orb3184705-03 100 µL

DR5 Recombinant Rabbit mAb

Sign In for Pricing
View Details