Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmlhe Peptide - C-terminal region

Tmlhe Peptide - C-terminal region

Product Specifications

Product Name Alternative

Tmlh

UniProt

Q91ZW6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmlhe Rabbit Polyclonal Antibody (orb583462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_596878

Preservative

Lyophilized powder

AA Sequence

ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken cluster of differentiation 73 (CD73) ELISA Kit
GTR10363823 96 Well

Chicken cluster of differentiation 73 (CD73) ELISA Kit

Sign In for Pricing
View Details
Recombinant human CD33 protein with C-terminal human Fc and 6xHis tag
MBS188094-01 0.01 mg

Recombinant human CD33 protein with C-terminal human Fc and 6xHis tag

Sign In for Pricing
View Details
Recombinant human CD33 protein with C-terminal human Fc and 6xHis tag
MBS188094-02 0.05 mg

Recombinant human CD33 protein with C-terminal human Fc and 6xHis tag

Sign In for Pricing
View Details
Recombinant human CD33 protein with C-terminal human Fc and 6xHis tag
MBS188094-03 0.1 mg

Recombinant human CD33 protein with C-terminal human Fc and 6xHis tag

Sign In for Pricing
View Details
Recombinant human CD33 protein with C-terminal human Fc and 6xHis tag
MBS188094-04 5x 0.1 mg

Recombinant human CD33 protein with C-terminal human Fc and 6xHis tag

Sign In for Pricing
View Details
Speedy A (h) -PR
sc-94630-PR 10 µM - 20 µL

Speedy A (h) -PR

Sign In for Pricing
View Details