Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIPAS39 Peptide - middle region

VIPAS39 Peptide - middle region

Product Specifications

Product Name Alternative

Spe39, Vipar, hSPE-39

UniProt

Q5PQN6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VIPAS39 Rabbit Polyclonal Antibody (orb326215) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094474

Preservative

Lyophilized powder

AA Sequence

PPSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKTYSPELGRPKGEYRDYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Semaphorin 4D Monoclonal Antibody
E-AB-81485-01 50 µL

Recombinant Semaphorin 4D Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Semaphorin 4D Monoclonal Antibody
E-AB-81485-02 100 µL

Recombinant Semaphorin 4D Monoclonal Antibody

Sign In for Pricing
View Details
Zfp12 Mouse Gene Knockout Kit (CRISPR)
KN519727 1 Kit

Zfp12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR561884 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Candidatus Liberibacter TaqMan PCR Kit
TM64350 100 Reactions

Candidatus Liberibacter TaqMan PCR Kit

Sign In for Pricing
View Details
Bcl-2 (BCL2/782), CF640R conjugate, 0.1mg/mL
BNC400782-500 1x 500 µL

Bcl-2 (BCL2/782), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details