Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIPAS39 Peptide - middle region

VIPAS39 Peptide - middle region

Product Specifications

Product Name Alternative

Spe39, Vipar, hSPE-39

UniProt

Q5PQN6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VIPAS39 Rabbit Polyclonal Antibody (orb326215) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094474

Preservative

Lyophilized powder

AA Sequence

PPSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKTYSPELGRPKGEYRDYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thada Mouse Gene Knockout Kit (CRISPR)
KN517509 1 Kit

Thada Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF405S conjugate, 0.1mg/mL
BNC042318-100 1x 100 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cbx4 Mouse Gene Knockout Kit (CRISPR)
KN502612 1 Kit

Cbx4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS801249 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
C20orf31 (EDEM2) Human Gene Knockout Kit (CRISPR)
KN400124 1 Kit

C20orf31 (EDEM2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPGRIP1 Human Gene Knockout Kit (CRISPR)
KN417420 1 Kit

RPGRIP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details