Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elf2 Peptide - middle region

Elf2 Peptide - middle region

Product Specifications

UniProt

Q5XIS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Elf2 Rabbit Polyclonal Antibody (orb583748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012181

Preservative

Lyophilized powder

AA Sequence

TCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calnexin (CANX) (NM_001746) Human Recombinant Protein
TP300229M 100 µg

Calnexin (CANX) (NM_001746) Human Recombinant Protein

Sign In for Pricing
View Details
CIDE-A, CT (Cell Death-inducing DFF-like Effector A)
C5072-01 100 µg

CIDE-A, CT (Cell Death-inducing DFF-like Effector A)

Sign In for Pricing
View Details
WBP2 siRNA (Rat)
MBS8207695-01 15 nmol

WBP2 siRNA (Rat)

Sign In for Pricing
View Details
WBP2 siRNA (Rat)
MBS8207695-02 30 nmol

WBP2 siRNA (Rat)

Sign In for Pricing
View Details
WBP2 siRNA (Rat)
MBS8207695-03 5x 30 nmol

WBP2 siRNA (Rat)

Sign In for Pricing
View Details
Doxazosin 5mg
A17779-5 5 mg

Doxazosin 5mg

Sign In for Pricing
View Details