Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elf2 Peptide - middle region

Elf2 Peptide - middle region

Product Specifications

UniProt

Q5XIS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Elf2 Rabbit Polyclonal Antibody (orb583748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012181

Preservative

Lyophilized powder

AA Sequence

TCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) ELISA kit
GTR10450349 96 Well

Chicken High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) ELISA kit

Sign In for Pricing
View Details
Nup98 Protein Vector (Mouse) (pPM-C-HA)
32342024 500 ng

Nup98 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Caspase-8 Rabbit Monoclonal Antibody
MBS179058-01 0.03 mL

Anti-Caspase-8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Caspase-8 Rabbit Monoclonal Antibody
MBS179058-02 0.1 mL

Anti-Caspase-8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Caspase-8 Rabbit Monoclonal Antibody
MBS179058-03 5x 0.1 mL

Anti-Caspase-8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD40 protein
80R-4343 0.05 mg

CD40 protein

Sign In for Pricing
View Details