Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mprip Peptide - middle region

Mprip Peptide - middle region

Product Specifications

Product Name Alternative

M-rip, Mrip, Rhoip3, p116Rip

UniProt

Q9ERE6

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mprip Rabbit Polyclonal Antibody (orb583750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446266

Preservative

Lyophilized powder

AA Sequence

ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arpp21 Peptide - N-terminal region
MBS3231048-01 0.1 mg

Arpp21 Peptide - N-terminal region

Sign In for Pricing
View Details
Arpp21 Peptide - N-terminal region
MBS3231048-02 5x 0.1 mg

Arpp21 Peptide - N-terminal region

Sign In for Pricing
View Details
ATP8B1-set siRNA/shRNA/RNAi Lentivector (Human)
12818091 4x 500 ng

ATP8B1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Asxl3 siRNA Oligos set (Mouse)
12592174 3x 5 nmol

Asxl3 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
BABAM1 Rabbit Polyclonal Antibody
orb3070749-01 30 µL

BABAM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BABAM1 Rabbit Polyclonal Antibody
orb3070749-02 50 µL

BABAM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details