Tmem173 Peptide - C-terminal region
Tmem173 Peptide - C-terminal region
Product Specifications
Product Name Alternative
TMEM173
UniProt
I3P832
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tmem173 Rabbit Polyclonal Antibody (orb584202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001102592
Preservative
Lyophilized powder
AA Sequence
LFAMSQDGKAGFSREDRLEQAKLFCRTLEEILADVPESRNHCRLIVYQES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880146-500 1x 500 µL
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880053-500 1x 500 µL
HCG-alpha (HCGa/53), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742462-100 1x 100 µL
Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC700774-100 1x 100 µL
HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 