Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atg7 Peptide - C-terminal region

Atg7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Apg7l

UniProt

Q641Y5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atg7 Rabbit Polyclonal Antibody (orb584213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012097

Preservative

Lyophilized powder

AA Sequence

KLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFANI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optical DO process electrode for HI510/HI520,10m cable
HI7640-5815 1 Each

Optical DO process electrode for HI510/HI520,10m cable

Sign In for Pricing
View Details
Plppr5 (NM_029425) Mouse Tagged ORF Clone Lentiviral Particle
MR204537L3V 200 µL

Plppr5 (NM_029425) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit
MBS721338-01 48 Well

Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit

Sign In for Pricing
View Details
Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit
MBS721338-02 96 Well

Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit

Sign In for Pricing
View Details
Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit
MBS721338-03 5x 96 Well

Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit

Sign In for Pricing
View Details
Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit
MBS721338-04 10x 96 Well

Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit

Sign In for Pricing
View Details