Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atg7 Peptide - C-terminal region

Atg7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Apg7l

UniProt

Q641Y5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atg7 Rabbit Polyclonal Antibody (orb584213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012097

Preservative

Lyophilized powder

AA Sequence

KLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFANI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Mouse IgG2a, Human ads-CY5
1080-15 1 mg

Goat Anti-Mouse IgG2a, Human ads-CY5

Sign In for Pricing
View Details
FGL1 Rabbit Polyclonal Antibody (APC)
orb2702150 100 µg

FGL1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
DEFB118 3'UTR Lenti-reporter-Luc Vector
17940081 1.0 µg

DEFB118 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TRPM8 Rabbit Polyclonal Antibody (Cy7)
orb2437721 100 µL

TRPM8 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
25-Hydroxyvitamin D2 D3 LC-MS/MS Tune Mix
ZV-3046-02TM-10 2 mL

25-Hydroxyvitamin D2 D3 LC-MS/MS Tune Mix

Sign In for Pricing
View Details
XPA (DNA Repair Protein Complementing XP-A Cells, XP1, XPAC,) (MaxLight 650)
MBS6443543-01 0.1 mL

XPA (DNA Repair Protein Complementing XP-A Cells, XP1, XPAC,) (MaxLight 650)

Sign In for Pricing
View Details