Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cd247 Peptide - C-terminal region

Cd247 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cd3z, TCRzeta

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cd247 Rabbit Polyclonal Antibody (orb584220) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001192233

Preservative

Lyophilized powder

AA Sequence

ALQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRT2.1 Antibody
orb792860 2 mg

NRT2.1 Antibody

Sign In for Pricing
View Details
Human Cholecystokinin Tetrapeptide (CCK4) Protein
abx166445-01 10 µg

Human Cholecystokinin Tetrapeptide (CCK4) Protein

Sign In for Pricing
View Details
Human Cholecystokinin Tetrapeptide (CCK4) Protein
abx166445-02 50 µg

Human Cholecystokinin Tetrapeptide (CCK4) Protein

Sign In for Pricing
View Details
Human Cholecystokinin Tetrapeptide (CCK4) Protein
abx166445-03 100 µg

Human Cholecystokinin Tetrapeptide (CCK4) Protein

Sign In for Pricing
View Details
Human Cholecystokinin Tetrapeptide (CCK4) Protein
abx166445-04 200 µg

Human Cholecystokinin Tetrapeptide (CCK4) Protein

Sign In for Pricing
View Details
Human Cholecystokinin Tetrapeptide (CCK4) Protein
abx166445-05 500 µg

Human Cholecystokinin Tetrapeptide (CCK4) Protein

Sign In for Pricing
View Details