Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cd247 Peptide - C-terminal region

Cd247 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cd3z, TCRzeta

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cd247 Rabbit Polyclonal Antibody (orb584220) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001192233

Preservative

Lyophilized powder

AA Sequence

ALQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Ubiquitin-like protein ISG15 (ISG15) ELISA Kit
orb1668245-01 48 Tests

Pig Ubiquitin-like protein ISG15 (ISG15) ELISA Kit

Sign In for Pricing
View Details
Pig Ubiquitin-like protein ISG15 (ISG15) ELISA Kit
orb1668245-02 96 Tests

Pig Ubiquitin-like protein ISG15 (ISG15) ELISA Kit

Sign In for Pricing
View Details
AccuRapidTM Cloning Kit
K-7120 20 Reactions

AccuRapidTM Cloning Kit

Sign In for Pricing
View Details
PCBP2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62729R-BF594-TR 20 µL

PCBP2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Caspase 12 Blocking Peptide
33R-10701 50 ug

Caspase 12 Blocking Peptide

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Serine-protein kinase rsbW (rsbW)
MBS1438466-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis Serine-protein kinase rsbW (rsbW)

Sign In for Pricing
View Details