Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ambp Peptide - C-terminal region

Ambp Peptide - C-terminal region

Product Specifications

UniProt

Q64240

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ambp Rabbit Polyclonal Antibody (orb584239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037033

Preservative

Lyophilized powder

AA Sequence

ELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hmgn5 activation kit by CRISPRa
GA205390 1 Kit

Mouse Hmgn5 activation kit by CRISPRa

Sign In for Pricing
View Details
Ethyl 4-amino-3-fluorobenzoate
TRC-E899500-2.5G 2.5 g

Ethyl 4-amino-3-fluorobenzoate

Sign In for Pricing
View Details
Glycerol Trilinoleate
TRC-G601535-50MG 50 mg

Glycerol Trilinoleate

Sign In for Pricing
View Details
L-Glutamic Acid a-tert-Butyl Ester
TRC-G596980-25G 25 g

L-Glutamic Acid a-tert-Butyl Ester

Sign In for Pricing
View Details
RING finger protein unkempt like (UNKL) Human Gene Knockout Kit (CRISPR)
KN401609 1 Kit

RING finger protein unkempt like (UNKL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Panobacumab Biosimilar - Research Grade
ICH5174-1mg 1 mg

Panobacumab Biosimilar - Research Grade

Sign In for Pricing
View Details