Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ambp Peptide - C-terminal region

Ambp Peptide - C-terminal region

Product Specifications

UniProt

Q64240

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ambp Rabbit Polyclonal Antibody (orb584239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037033

Preservative

Lyophilized powder

AA Sequence

ELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Septin 3 (SEPT3) activation kit by CRISPRa
GA111072 1 Kit

Human Septin 3 (SEPT3) activation kit by CRISPRa

Sign In for Pricing
View Details
HLA-DOA Antibody
8C16218-AAT 50 µg

HLA-DOA Antibody

Sign In for Pricing
View Details
PARK7 Mouse Monoclonal Antibody [Clone ID: AT1E12]
AM50077PU-N 100 µL

PARK7 Mouse Monoclonal Antibody [Clone ID: AT1E12]

Sign In for Pricing
View Details
1,2,3,4,6,7-Hexachloronaphthalene + 1,2,3,5,6,7-Hexachloronaphthalene (Mixture) (~90%)
TRC-H293720-1G 1 g

1,2,3,4,6,7-Hexachloronaphthalene + 1,2,3,5,6,7-Hexachloronaphthalene (Mixture) (~90%)

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/2092R), 0.2mg/mL
BNUB2092-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/2092R), 0.2mg/mL

Sign In for Pricing
View Details
Glutathione peroxidase 1 Recombinant Mouse Monoclonal Antibody [C5-A10-R]
HA601200 100 µL

Glutathione peroxidase 1 Recombinant Mouse Monoclonal Antibody [C5-A10-R]

Sign In for Pricing
View Details