Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uchl3 Peptide - middle region

Uchl3 Peptide - middle region

Product Specifications

UniProt

Q9JKB1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Uchl3 Rabbit Polyclonal Antibody (orb584290) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057932

Preservative

Lyophilized powder

AA Sequence

IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Stomach
CS645393 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Wdr45 Mouse Gene Knockout Kit (CRISPR)
KN319361RB 1 Kit

Wdr45 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS701259 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
CBX3 Antibody
KC-6253-01 50 μL

CBX3 Antibody

Sign In for Pricing
View Details
CBX3 Antibody
KC-6253-02 100 µL

CBX3 Antibody

Sign In for Pricing
View Details
CBX3 Antibody
KC-6253-03 1 mL

CBX3 Antibody

Sign In for Pricing
View Details