Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uchl3 Peptide - middle region

Uchl3 Peptide - middle region

Product Specifications

UniProt

Q9JKB1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Uchl3 Rabbit Polyclonal Antibody (orb584290) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057932

Preservative

Lyophilized powder

AA Sequence

IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF770 activation kit by CRISPRa
GA110432 1 Kit

Human ZNF770 activation kit by CRISPRa

Sign In for Pricing
View Details
TEAD4 Human Gene Knockout Kit (CRISPR)
KN401978 1 Kit

TEAD4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD117 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E2]
TA801037AM 100 µL

CD117 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E2]

Sign In for Pricing
View Details
4-Fluoroephedrone-d3 Hydrochloride (1.0mg/ml in Acetonitrile)
TRC-KIT4765-1X1ML 1 mL

4-Fluoroephedrone-d3 Hydrochloride (1.0mg/ml in Acetonitrile)

Sign In for Pricing
View Details
ASCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]
TA503721AM 100 µL

ASCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]

Sign In for Pricing
View Details
Smgc Goat Polyclonal Antibody
AP31966PU-N 100 µg

Smgc Goat Polyclonal Antibody

Sign In for Pricing
View Details