Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubash3b Peptide - C-terminal region

Ubash3b Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1310357, Sts-1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubash3b Rabbit Polyclonal Antibody (orb584329) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178721

Preservative

Lyophilized powder

AA Sequence

AHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP53, Phosphorylated (S37) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (MaxLight 550)
MBS6441342-01 0.1 mL

TP53, Phosphorylated (S37) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (MaxLight 550)

Sign In for Pricing
View Details
TP53, Phosphorylated (S37) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (MaxLight 550)
MBS6441342-02 5x 0.1 mL

TP53, Phosphorylated (S37) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (MaxLight 550)

Sign In for Pricing
View Details
GLIPR1 Rabbit Polyclonal Antibody
orb1174552 100 µg

GLIPR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D2HGDH Antibody (Biotin)
orb354528-01 50 µg

D2HGDH Antibody (Biotin)

Sign In for Pricing
View Details
D2HGDH Antibody (Biotin)
orb354528-02 100 µg

D2HGDH Antibody (Biotin)

Sign In for Pricing
View Details
DPYD-AS2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV723346 1.0 µg DNA

DPYD-AS2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details