Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubash3b Peptide - C-terminal region

Ubash3b Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1310357, Sts-1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubash3b Rabbit Polyclonal Antibody (orb584329) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178721

Preservative

Lyophilized powder

AA Sequence

AHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc105 (NM_001025774) Rat Tagged Lenti ORF Clone
RR200700L4 10 µg

Ccdc105 (NM_001025774) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
beta hCG ELISA Kit
GDB71825 96 Tests

beta hCG ELISA Kit

Sign In for Pricing
View Details
pCMV-SPORT6-REM2 Plasmid
PVT24021 2 µg

pCMV-SPORT6-REM2 Plasmid

Sign In for Pricing
View Details
Lentiviral human RHOBTB3 shRNA (UAS) - Lentiviral human RHOBTB3 shRNA (UAS, GFP) (100)
GTR15328596 1 Vial

Lentiviral human RHOBTB3 shRNA (UAS) - Lentiviral human RHOBTB3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rad51 Rabbit Polyclonal Antibody (Biotin)
orb460838 100 µL

Rad51 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal OLFM4 Antibody (02) [Biotin]
NBP3-06414B 0.1 mL

Mouse Monoclonal OLFM4 Antibody (02) [Biotin]

Sign In for Pricing
View Details