Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Syt1 Peptide - N-terminal region

Syt1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P65

UniProt

P21707

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Syt1 Rabbit Polyclonal Antibody (orb331046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028852

Preservative

Lyophilized powder

AA Sequence

KDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-100 1x 100 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-100 1x 100 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), Biotin conjugate, 0.1mg/mL
BNCB0181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), CF640R conjugate, 0.1mg/mL
BNC401266-100 1x 100 µL

Cytokeratin 8 (KRT8) (B22.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF740 conjugate, 0.1mg/mL
BNC741175-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details