Nckipsd Peptide - C-terminal region
Nckipsd Peptide - C-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Nckipsd Rabbit Polyclonal Antibody (orb584361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001100327
Preservative
Lyophilized powder
AA Sequence
LPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEDVIRCYLEELLH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY419358 100 µg
Midkine (MDK) (NM_002391) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC471214-100 1x 100 µL
Luteinizing Hormone beta (LH beta) (LHb/1214), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN203330LP 1 Kit
Peroxiredoxin 4 (PRDX4) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
L-4603-1 1 mg
Pure Vicia villosa Lectin (Hairy VetchMannose Specific)
Sign In for Pricing
View Details