Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nckipsd Peptide - C-terminal region

Nckipsd Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nckipsd Rabbit Polyclonal Antibody (orb584361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100327

Preservative

Lyophilized powder

AA Sequence

LPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEDVIRCYLEELLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2-Fluoro-4-iodoanilino)-3,4-difluorobenzoic Acid
TRC-F591960-5G 5 g

2-(2-Fluoro-4-iodoanilino)-3,4-difluorobenzoic Acid

Sign In for Pricing
View Details
INSM1 Antibody
KC-2700-01 50 μL

INSM1 Antibody

Sign In for Pricing
View Details
INSM1 Antibody
KC-2700-02 100 µL

INSM1 Antibody

Sign In for Pricing
View Details
INSM1 Antibody
KC-2700-03 1 mL

INSM1 Antibody

Sign In for Pricing
View Details
CD47 Mouse Monoclonal Antibody [1A9]
EM1701-38 100 µL

CD47 Mouse Monoclonal Antibody [1A9]

Sign In for Pricing
View Details
Human C9orf78 activation kit by CRISPRa
GA109978 1 Kit

Human C9orf78 activation kit by CRISPRa

Sign In for Pricing
View Details