Snap29 Peptide - middle region
Snap29 Peptide - middle region
Product Specifications
Product Name Alternative
Gs32
UniProt
Q9JI56
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Snap29 Rabbit Polyclonal Antibody (orb584363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_446262
Preservative
Lyophilized powder
AA Sequence
QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2099190-01 5x 96 Tests
Mouse Neuroglobin (NGB) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2099190-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)
Mouse Neuroglobin (NGB) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2099190-03 10x 96 Tests
Mouse Neuroglobin (NGB) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2099190-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)
Mouse Neuroglobin (NGB) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details 