Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snap29 Peptide - middle region

Snap29 Peptide - middle region

Product Specifications

Product Name Alternative

Gs32

UniProt

Q9JI56

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Snap29 Rabbit Polyclonal Antibody (orb584363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446262

Preservative

Lyophilized powder

AA Sequence

QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Fluoro-2-hydroxy benzaldehyde
276038-01 1 g

3-Fluoro-2-hydroxy benzaldehyde

Sign In for Pricing
View Details
3-Fluoro-2-hydroxy benzaldehyde
276038-02 2 g

3-Fluoro-2-hydroxy benzaldehyde

Sign In for Pricing
View Details
3-Fluoro-2-hydroxy benzaldehyde
276038-03 5 g

3-Fluoro-2-hydroxy benzaldehyde

Sign In for Pricing
View Details
3-Fluoro-2-hydroxy benzaldehyde
276038-04 10 g

3-Fluoro-2-hydroxy benzaldehyde

Sign In for Pricing
View Details
3-Fluoro-2-hydroxy benzaldehyde
276038-05 25 g

3-Fluoro-2-hydroxy benzaldehyde

Sign In for Pricing
View Details
F (ab) 2 Goat anti-Hamster IgG h+l (min. reactivity w/ Ms, Rt) - Affinity Purified
70-1256 1 mg

F (ab) 2 Goat anti-Hamster IgG h+l (min. reactivity w/ Ms, Rt) - Affinity Purified

Sign In for Pricing
View Details