Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sstr1 Peptide - C-terminal region

Sstr1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SRIF-2, SS-1-R, SS1-R, SS1R, Smstr-1, Smstr1, sst1

UniProt

P30873

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sstr1 Rabbit Polyclonal Antibody (orb584376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033242

Preservative

Lyophilized powder

AA Sequence

QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1250ul Filter pipette tips
TF-1250-R-SLD-1 96 / Box

1250ul Filter pipette tips

Sign In for Pricing
View Details
LOC500270 Protein Vector (Rat) (pPB-N-His)
PV278843 500 ng

LOC500270 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
PEX5 Rabbit pAb, PE-Cy5.5 conjugated
orb2826609 100 µL

PEX5 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Recombinant Human CD3D
MBS7621821-01 0.01 mg

Recombinant Human CD3D

Sign In for Pricing
View Details
Recombinant Human CD3D
MBS7621821-02 0.05 mg

Recombinant Human CD3D

Sign In for Pricing
View Details
Recombinant Human CD3D
MBS7621821-03 0.5 mg

Recombinant Human CD3D

Sign In for Pricing
View Details