Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sstr1 Peptide - C-terminal region

Sstr1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SRIF-2, SS-1-R, SS1-R, SS1R, Smstr-1, Smstr1, sst1

UniProt

P30873

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sstr1 Rabbit Polyclonal Antibody (orb584376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033242

Preservative

Lyophilized powder

AA Sequence

QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACM2 Rabbit mAb
AB101178 100 µL

ACM2 Rabbit mAb

Sign In for Pricing
View Details
Slc28a3 3'UTR GFP Stable Cell Line
TU169049 1.0 mL

Slc28a3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-Hsp27 Antibody
11120 100ug

Anti-Hsp27 Antibody

Sign In for Pricing
View Details
InVivoMAb Anti-HPV16 L2/Minor capsid protein L2 (Iv0015)
VK658020-01 50 µg

InVivoMAb Anti-HPV16 L2/Minor capsid protein L2 (Iv0015)

Sign In for Pricing
View Details
InVivoMAb Anti-HPV16 L2/Minor capsid protein L2 (Iv0015)
VK658020-02 100 µg

InVivoMAb Anti-HPV16 L2/Minor capsid protein L2 (Iv0015)

Sign In for Pricing
View Details
InVivoMAb Anti-HPV16 L2/Minor capsid protein L2 (Iv0015)
VK658020-03 1 mg

InVivoMAb Anti-HPV16 L2/Minor capsid protein L2 (Iv0015)

Sign In for Pricing
View Details