Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olr10 Peptide - C-terminal region

Olr10 Peptide - C-terminal region

Product Specifications

UniProt

D4A4K1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olr10 Rabbit Polyclonal Antibody (orb326309) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001000115

Preservative

Lyophilized powder

AA Sequence

RPTSSQHSPGRDRLISMLYAVITPMLNPIIYSLRNKEVKGALRKVLHLRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2E)-3-Fluoro-4-hydroxycinnamic Acid
TRC-F599228-50MG 50 mg

(2E)-3-Fluoro-4-hydroxycinnamic Acid

Sign In for Pricing
View Details
LTB Antibody
KC-3294-01 50 μL

LTB Antibody

Sign In for Pricing
View Details
LTB Antibody
KC-3294-02 100 µL

LTB Antibody

Sign In for Pricing
View Details
LTB Antibody
KC-3294-03 1 mL

LTB Antibody

Sign In for Pricing
View Details
Aven Mouse Gene Knockout Kit (CRISPR)
KN501876 1 Kit

Aven Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein, His Tag (BA.2.38/Omicron) (MALS verified)
SPD-C522w-1mg 1 mg

SARS-CoV-2 Spike RBD Protein, His Tag (BA.2.38/Omicron) (MALS verified)

Sign In for Pricing
View Details