Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olr10 Peptide - C-terminal region

Olr10 Peptide - C-terminal region

Product Specifications

UniProt

D4A4K1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olr10 Rabbit Polyclonal Antibody (orb326309) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001000115

Preservative

Lyophilized powder

AA Sequence

RPTSSQHSPGRDRLISMLYAVITPMLNPIIYSLRNKEVKGALRKVLHLRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epidermal Growth Factor Receptor Antibody
F50597-0.4ML 0.4 mL

Epidermal Growth Factor Receptor Antibody

Sign In for Pricing
View Details
MED15 Mouse Monoclonal Antibody [Clone ID: OTI1H5]
CF807919 100 µg

MED15 Mouse Monoclonal Antibody [Clone ID: OTI1H5]

Sign In for Pricing
View Details
PSMD1 Antibody
KC-1427-01 50 μL

PSMD1 Antibody

Sign In for Pricing
View Details
PSMD1 Antibody
KC-1427-02 100 µL

PSMD1 Antibody

Sign In for Pricing
View Details
PSMD1 Antibody
KC-1427-03 1 mL

PSMD1 Antibody

Sign In for Pricing
View Details
SSB (NM_003142) Human Over-expression Lysate
LC401091 20 µg

SSB (NM_003142) Human Over-expression Lysate

Sign In for Pricing
View Details