Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh1a2 Peptide - C-terminal region

Aldh1a2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AV116159, Aldh1a7, Raldh1, Raldh2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aldh1a2 Rabbit Polyclonal Antibody (orb331068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033048

Preservative

Lyophilized powder

AA Sequence

ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNA-binding protein 38 (RBM38) Chicken ELISA Kit
G8303 96 Tests

RNA-binding protein 38 (RBM38) Chicken ELISA Kit

Sign In for Pricing
View Details
Gm10318 3'UTR Lenti-reporter-Luc Vector
21690084 1.0 µg

Gm10318 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Macrophage Inflammatory Protein 1delta (MIP-1delta/CCL15) ELISA Kit
MBS9316017-01 48 Well

Mouse Macrophage Inflammatory Protein 1delta (MIP-1delta/CCL15) ELISA Kit

Sign In for Pricing
View Details
Mouse Macrophage Inflammatory Protein 1delta (MIP-1delta/CCL15) ELISA Kit
MBS9316017-02 96 Well

Mouse Macrophage Inflammatory Protein 1delta (MIP-1delta/CCL15) ELISA Kit

Sign In for Pricing
View Details
Mouse Macrophage Inflammatory Protein 1delta (MIP-1delta/CCL15) ELISA Kit
MBS9316017-03 5x 96 Well

Mouse Macrophage Inflammatory Protein 1delta (MIP-1delta/CCL15) ELISA Kit

Sign In for Pricing
View Details
Mouse Macrophage Inflammatory Protein 1delta (MIP-1delta/CCL15) ELISA Kit
MBS9316017-04 10x 96 Well

Mouse Macrophage Inflammatory Protein 1delta (MIP-1delta/CCL15) ELISA Kit

Sign In for Pricing
View Details