Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh1a2 Peptide - C-terminal region

Aldh1a2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AV116159, Aldh1a7, Raldh1, Raldh2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aldh1a2 Rabbit Polyclonal Antibody (orb331068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033048

Preservative

Lyophilized powder

AA Sequence

ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSIP1 Rabbit Polyclonal Antibody (Biotin)
orb2585371 100 µg

PSIP1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
VNN1 (Vanin 1, HDLCQ8, MGC116930, MGC116931, MGC116932, MGC116933, Tiff66) (Biotin)
MBS6172632-01 0.1 mL

VNN1 (Vanin 1, HDLCQ8, MGC116930, MGC116931, MGC116932, MGC116933, Tiff66) (Biotin)

Sign In for Pricing
View Details
VNN1 (Vanin 1, HDLCQ8, MGC116930, MGC116931, MGC116932, MGC116933, Tiff66) (Biotin)
MBS6172632-02 5x 0.1 mL

VNN1 (Vanin 1, HDLCQ8, MGC116930, MGC116931, MGC116932, MGC116933, Tiff66) (Biotin)

Sign In for Pricing
View Details
6-Bromo-8-Methoxy-2H-Chromene-3-Carboxylic Acid
266733-01 50 mg

6-Bromo-8-Methoxy-2H-Chromene-3-Carboxylic Acid

Sign In for Pricing
View Details
6-Bromo-8-Methoxy-2H-Chromene-3-Carboxylic Acid
266733-02 100 mg

6-Bromo-8-Methoxy-2H-Chromene-3-Carboxylic Acid

Sign In for Pricing
View Details
6-Bromo-8-Methoxy-2H-Chromene-3-Carboxylic Acid
266733-03 250 mg

6-Bromo-8-Methoxy-2H-Chromene-3-Carboxylic Acid

Sign In for Pricing
View Details