Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clta Peptide - C-terminal region

Clta Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCA1, LCA2, LCA3

UniProt

P08081

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clta Rabbit Polyclonal Antibody (orb331077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114180

Preservative

Lyophilized powder

AA Sequence

EQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octyl-b-D glucopyranoside
RM7333-1G 1 unit

Octyl-b-D glucopyranoside

Sign In for Pricing
View Details
BRD1 Adenovirus (Mouse)
13457054 1.0 mL

BRD1 Adenovirus (Mouse)

Sign In for Pricing
View Details
PMS2 Antibody
A60734-50UL 50 μL

PMS2 Antibody

Sign In for Pricing
View Details
Easypro Rat Cfd (Complement Factor D) ELISA Kit
FY-ER2732S 96 Well

Easypro Rat Cfd (Complement Factor D) ELISA Kit

Sign In for Pricing
View Details
COL4A6 (G-2) : m-IgG1 BP-HRP Bundle
sc-544301 1 Kit

COL4A6 (G-2) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Itgam AAV siRNA Pooled Vector
25161164 1.0 µg

Itgam AAV siRNA Pooled Vector

Sign In for Pricing
View Details