Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clta Peptide - C-terminal region

Clta Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCA1, LCA2, LCA3

UniProt

P08081

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clta Rabbit Polyclonal Antibody (orb331077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114180

Preservative

Lyophilized powder

AA Sequence

EQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAIAP2 Polyclonal Antibody
ANT-10404-50ug 50 µg

BAIAP2 Polyclonal Antibody

Sign In for Pricing
View Details
RHBDF2 Protein Vector (Human) (pPM-C-His)
PV035152 500 ng

RHBDF2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CDK6 Rabbit Polyclonal Antibody
TA323938 100 µL

CDK6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal ROR1 Antibody (OTI3D11) - Azide and BSA Free
NBP2-73931 100 µg

Mouse Monoclonal ROR1 Antibody (OTI3D11) - Azide and BSA Free

Sign In for Pricing
View Details
Mut Mouse shRNA Plasmid (Locus ID 17850)
TR501402 1 Kit

Mut Mouse shRNA Plasmid (Locus ID 17850)

Sign In for Pricing
View Details
LTV1 CRISPR/Cas9 KO Plasmid (m)
sc-436149 20 µg

LTV1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details