Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clta Peptide - C-terminal region

Clta Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCA1, LCA2, LCA3

UniProt

P08081

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clta Rabbit Polyclonal Antibody (orb331077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114180

Preservative

Lyophilized powder

AA Sequence

EQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus subtilis UPF0753 protein ybcC (ybcC), partial
MBS1156606 Inquire

Recombinant Bacillus subtilis UPF0753 protein ybcC (ybcC), partial

Sign In for Pricing
View Details
Mouse Inositol-trisphosphate 3-kinase A (ITPKA) ELISA Kit
abx528495 96 Tests

Mouse Inositol-trisphosphate 3-kinase A (ITPKA) ELISA Kit

Sign In for Pricing
View Details
Easypro Rat Hepc (Hepcidin) ELISA Kit
FY-ER2736S 96 Well

Easypro Rat Hepc (Hepcidin) ELISA Kit

Sign In for Pricing
View Details
Tcam1 (NM_021673) Rat Tagged Lenti ORF Clone
RR212656L4 10 µg

Tcam1 (NM_021673) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Creatine Kinase (CK/CPK)
MBS173707-01 3000 Units

Creatine Kinase (CK/CPK)

Sign In for Pricing
View Details
Creatine Kinase (CK/CPK)
MBS173707-02 100 K Units

Creatine Kinase (CK/CPK)

Sign In for Pricing
View Details