Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp1a1 Peptide - middle region

Atp1a1 Peptide - middle region

Product Specifications

Product Name Alternative

Nkaa1b

UniProt

P06685

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp1a1 Rabbit Polyclonal Antibody (orb584608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036636

Preservative

Lyophilized powder

AA Sequence

KHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAb human 1 Step RIA Kit [CE]
KIPM2042 96 Tests

TRAb human 1 Step RIA Kit [CE]

Sign In for Pricing
View Details
Fyn 3'UTR Lenti-reporter-Luc Vector
21104086 1.0 µg

Fyn 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MSH6 Rabbit mAb
C05558-01 20 µL

MSH6 Rabbit mAb

Sign In for Pricing
View Details
MSH6 Rabbit mAb
C05558-02 100 µL

MSH6 Rabbit mAb

Sign In for Pricing
View Details
MSH6 Rabbit mAb
C05558-03 2x 100 μL

MSH6 Rabbit mAb

Sign In for Pricing
View Details
Quick Reversible Stain
40640000-2 2 Kits

Quick Reversible Stain

Sign In for Pricing
View Details