Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp1a1 Peptide - middle region

Atp1a1 Peptide - middle region

Product Specifications

Product Name Alternative

Nkaa1b

UniProt

P06685

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp1a1 Rabbit Polyclonal Antibody (orb584608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036636

Preservative

Lyophilized powder

AA Sequence

KHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC116 (G-5) HRP
sc-514528 HRP 200 µg/mL

CCDC116 (G-5) HRP

Sign In for Pricing
View Details
Nerve Growth Factor, beta, 2.5S, 7S (NGF) (MaxLight 550) discontinued
N2050-06C-ML550 100 µL

Nerve Growth Factor, beta, 2.5S, 7S (NGF) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ZNF175 (NM_007147) Human Over-expression Lysate
E45H08542-2 20 µg

ZNF175 (NM_007147) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Shewanella loihica Iron-sulfur cluster insertion protein ErpA (erpA)
MBS1160759-01 0.02 mg (E-Coli)

Recombinant Shewanella loihica Iron-sulfur cluster insertion protein ErpA (erpA)

Sign In for Pricing
View Details
Recombinant Shewanella loihica Iron-sulfur cluster insertion protein ErpA (erpA)
MBS1160759-02 0.1 mg (E-Coli)

Recombinant Shewanella loihica Iron-sulfur cluster insertion protein ErpA (erpA)

Sign In for Pricing
View Details
Recombinant Shewanella loihica Iron-sulfur cluster insertion protein ErpA (erpA)
MBS1160759-03 0.02 mg (Yeast)

Recombinant Shewanella loihica Iron-sulfur cluster insertion protein ErpA (erpA)

Sign In for Pricing
View Details