Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dctn5 Peptide - N-terminal region

Dctn5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1305654

UniProt

Q4KM59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dctn5 Rabbit Polyclonal Antibody (orb584618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032867

Preservative

Lyophilized powder

AA Sequence

GELYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIIMNDCIIRGDLAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF568 conjugate, 0.1mg/mL
BNC682899-500 1x 500 µL

Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Telethonin (TCAP) Mouse Monoclonal Antibody [Clone ID: OTI1A7]
CF808340 100 µg

Telethonin (TCAP) Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details
Monoclonal Antibody to TLR6 (Clone: ABM1B50)
10-3002-100 100 µg

Monoclonal Antibody to TLR6 (Clone: ABM1B50)

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF488A conjugate, 0.1mg/mL
BNC882897-100 1x 100 µL

Major Vault Protein (MVP) (VP2897R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IRF5 Antibody
KC-1424-01 50 μL

IRF5 Antibody

Sign In for Pricing
View Details
IRF5 Antibody
KC-1424-02 100 µL

IRF5 Antibody

Sign In for Pricing
View Details