Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acbd6 Peptide - middle region

Acbd6 Peptide - middle region

Product Specifications

UniProt

Q5RJK8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Acbd6 Rabbit Polyclonal Antibody (orb584665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011906

Preservative

Lyophilized powder

AA Sequence

SEKKGKEGSSGFGGPVVSSLYHEETIREEDKNIFDYCRENNIDHITKAIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDOC1L (RTL6) (NM_032287) Human Tagged Lenti ORF Clone
RC206668L4 10 µg

LDOC1L (RTL6) (NM_032287) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MMP28 Antibody
A60218-100UL 100 µL

MMP28 Antibody

Sign In for Pricing
View Details
Schizandrol B
S9126-5mg 5 mg

Schizandrol B

Sign In for Pricing
View Details
pLV3×Myc-mCherry-Puro Plasmid
PVT53961 2 µg

pLV3×Myc-mCherry-Puro Plasmid

Sign In for Pricing
View Details
Anti-KIF15 Antibody Picoband®, iFluor647 Conjugate
A05983-1-iFluor647 100 µg

Anti-KIF15 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
KHS101 hcl
MBS132913 Inquire

KHS101 hcl

Sign In for Pricing
View Details