Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fyttd1 Peptide - middle region

Fyttd1 Peptide - middle region

Product Specifications

Product Name Alternative

RGD1306899

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fyttd1 Rabbit Polyclonal Antibody (orb584686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001041364

Preservative

Lyophilized powder

AA Sequence

TEQLIDDVVAKRTRQTQKPRLTRTAVPSFLTKREQSDVKKIPKGVPLQFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TRIM73 Antibody
RN-10998-01 50 μL

Recombinant TRIM73 Antibody

Sign In for Pricing
View Details
Recombinant TRIM73 Antibody
RN-10998-02 100 µL

Recombinant TRIM73 Antibody

Sign In for Pricing
View Details
Recombinant TRIM73 Antibody
RN-10998-03 1 mL

Recombinant TRIM73 Antibody

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2783), Biotin conjugate, 0.1mg/mL
BNCB2783-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2783), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CHRNA9 activation kit by CRISPRa
GA110802 1 Kit

Human CHRNA9 activation kit by CRISPRa

Sign In for Pricing
View Details
ABCB11 Human Gene Knockout Kit (CRISPR)
KN424122 1 Kit

ABCB11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details