Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fyttd1 Peptide - middle region

Fyttd1 Peptide - middle region

Product Specifications

Product Name Alternative

RGD1306899

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fyttd1 Rabbit Polyclonal Antibody (orb584686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001041364

Preservative

Lyophilized powder

AA Sequence

TEQLIDDVVAKRTRQTQKPRLTRTAVPSFLTKREQSDVKKIPKGVPLQFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CH5424802
TRC-C183360-25MG 25 mg

CH5424802

Sign In for Pricing
View Details
JAK2 Human Gene Knockout Kit (CRISPR)
KN420503 1 Kit

JAK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IFI27 Human Gene Knockout Kit (CRISPR)
KN401952 1 Kit

IFI27 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CYB5R3 Recombinant Rabbit Monoclonal Antibody [JE63-51]
HA721008 100 µL

CYB5R3 Recombinant Rabbit Monoclonal Antibody [JE63-51]

Sign In for Pricing
View Details
Hexestrol-d6 (hexane-2,2,3,4,5,5-d6) (meso)
TRC-H295301-5MG 5 mg

Hexestrol-d6 (hexane-2,2,3,4,5,5-d6) (meso)

Sign In for Pricing
View Details
Rpl27a (NM_011975) Mouse Tagged ORF Clone
MG201017 10 µg

Rpl27a (NM_011975) Mouse Tagged ORF Clone

Sign In for Pricing
View Details