Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpf2 Peptide - N-terminal region

Rpf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Bxdc1

UniProt

B0BN82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rpf2 Rabbit Polyclonal Antibody (orb326343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099861

Preservative

Lyophilized powder

AA Sequence

SLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIEKFVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac trans-2-Phenylcyclopropylamine Hydrochloride
TRC-P319680-250MG 250 mg

rac trans-2-Phenylcyclopropylamine Hydrochloride

Sign In for Pricing
View Details
FITC Conjugated Rabbit Polyclonal Antibody to Canine IgG
FA-2353-2 2 mL

FITC Conjugated Rabbit Polyclonal Antibody to Canine IgG

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1), CF647 conjugate, 0.1mg/mL
BNC470448-100 1x 100 µL

TTF-1 / NKX2.1 (8G7G3/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WDR74 Human Gene Knockout Kit (CRISPR)
KN421134 1 Kit

WDR74 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cpsf2 Mouse Gene Knockout Kit (CRISPR)
KN503776 1 Kit

Cpsf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
epsilon-Viniferin
TRC-E214470-10MG 10 mg

epsilon-Viniferin

Sign In for Pricing
View Details