Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpf2 Peptide - N-terminal region

Rpf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Bxdc1

UniProt

B0BN82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rpf2 Rabbit Polyclonal Antibody (orb326343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099861

Preservative

Lyophilized powder

AA Sequence

SLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIEKFVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lymphoid tissue
CR561847 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Human ANGPTL3 Recombinant Rabbit monoclonal Antibody
HA725079 100 µL

Human ANGPTL3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126G-01 20 Tests

PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126G-02 100 Tests

PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS644397 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details